PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00109493001
Common NameGSBRNA2T00109493001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 412aa    MW: 45904.7 Da    PI: 6.0266
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00109493001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1048.7e-33229283155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav+qLGGse+AtPk++l+l+k +gLt++hvkSHLQkYR+
  GSBRNA2T00109493001 229 KQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLKNPGLTIYHVKSHLQKYRT 283
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.832226286IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-30227285IPR009057Homeodomain-like
SuperFamilySSF466896.81E-17227283IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-23229283IPR006447Myb domain, plants
PfamPF002491.7E-10231282IPR001005SANT/Myb domain
PfamPF143799.1E-22317363IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MTLANDFGYS TAMSSSFSAL HATVEDRYRK FHSSFWGSSG QELMNNPVPC HVDNSGGGYL  60
FSSSSGYCNV SAVSAHGRTS QTHPPVSTMP SDRLAMQSSL INNHQPQEFS DPLDEFFDFS  120
DHVSAPNPQE DGSGVKLVSS LELREKSEWQ TWADQLMSVD NGSEPNWSEL LGEPSPHNPN  180
SQVPQRSHDL QQILTPPRQE VIANQQHQAV SSEEQLSGRN SSASGATSKQ RMRWTPELHE  240
AFVEAVNQLG GSERATPKAV LKLLKNPGLT IYHVKSHLQK YRTARYKPET SEATGEPQEK  300
KITSIEDIKS LDMKTSVEIT QALRLQMEVQ KRLHEQLEIQ RSLQLQIEKQ GRYLQMMFEK  360
QQKLQENNGS SSELSPKQCN GTSAEVEFGL EAQAVNQTEP ASSSRKRTRE D*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00109493001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0459430.0AY045943.1 Arabidopsis thaliana unknown protein (At5g29000) mRNA, partial cds.
GenBankAY0851540.0AY085154.1 Arabidopsis thaliana clone 13378 mRNA, complete sequence.
GenBankBT0023440.0BT002344.1 Arabidopsis thaliana clone C104936 unknown protein (At5g29000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013606816.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN50.0PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078EG250.0A0A078EG25_BRANA; BnaC09g02840D protein
STRINGBra036123.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.20.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]